![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
![]() | Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52957] (4 PDB entries) |
![]() | Domain d1kmna1: 1kmn A:326-424 [33182] Other proteins in same PDB: d1kmna2, d1kmnb2, d1kmnc2, d1kmnd2 |
PDB Entry: 1kmn (more details), 2.8 Å
SCOP Domain Sequences for d1kmna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmna1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg
Timeline for d1kmna1: