Lineage for d1httc1 (1htt C:326-424)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835189Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 835190Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) (S)
  5. 835191Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 835200Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 835204Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 835215Domain d1httc1: 1htt C:326-424 [33180]
    Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2

Details for d1httc1

PDB Entry: 1htt (more details), 2.6 Å

PDB Description: histidyl-trna synthetase
PDB Compounds: (C:) histidyl-tRNA synthetase

SCOP Domain Sequences for d1httc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1httc1 c.51.1.1 (C:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOP Domain Coordinates for d1httc1:

Click to download the PDB-style file with coordinates for d1httc1.
(The format of our PDB-style files is described here.)

Timeline for d1httc1: