Lineage for d1httb1 (1htt B:326-424)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2135876Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2135877Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)
  6. 2135886Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)
  7. 2135887Species Escherichia coli [TaxId:562] [52957] (4 PDB entries)
  8. 2135897Domain d1httb1: 1htt B:326-424 [33179]
    Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2
    protein/RNA complex; complexed with amp, his

Details for d1httb1

PDB Entry: 1htt (more details), 2.6 Å

PDB Description: histidyl-trna synthetase
PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1httb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1httb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

SCOPe Domain Coordinates for d1httb1:

Click to download the PDB-style file with coordinates for d1httb1.
(The format of our PDB-style files is described here.)

Timeline for d1httb1: