SCOP 1.57: Domain d1httb1: 1htt B:326-424

Lineage for d1httb1 (1htt B:326-424)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)

7. Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)

8. Domain d1httb1: 1htt B:326-424 [33179]
   Other proteins in same PDB: d1htta2, d1httb2, d1httc2, d1httd2

Details for d1httb1

PDB Entry: 1htt, 2.6 Å

PDB Description: histidyl-trna synthetase

SCOP Domain Sequences for d1httb1:

Sequence; same for both SEQRES and ATOM records:

>d1httb1 c.51.1.1 (B:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

Timeline for d1httb1:

• d1httb1 first appeared (with stable ids) in SCOP 1.55
  
• d1httb1 appears in SCOP 1.59
  
• d1httb1 appears in the current release, SCOPe 2.08