| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries) |
| Domain d5pcsa1: 5pcs A:1858-1970 [331779] Other proteins in same PDB: d5pcsa2 automated match to d3uv2a_ complexed with edo |
PDB Entry: 5pcs (more details), 1.83 Å
SCOPe Domain Sequences for d5pcsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5pcsa1 a.29.2.0 (A:1858-1970) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstirek
lssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk
Timeline for d5pcsa1: