SCOP 1.57: Domain d1kmmc1: 1kmm C:326-424

Lineage for d1kmmc1 (1kmm C:326-424)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)

7. Species Escherichia coli [TaxId:562] [52957] (3 PDB entries)

8. Domain d1kmmc1: 1kmm C:326-424 [33176]
   Other proteins in same PDB: d1kmma2, d1kmmb2, d1kmmc2, d1kmmd2

Details for d1kmmc1

PDB Entry: 1kmm, 2.6 Å

PDB Description: histidyl-trna synthetase complexed with histidyl-adenylate

SCOP Domain Sequences for d1kmmc1:

Sequence; same for both SEQRES and ATOM records:

>d1kmmc1 c.51.1.1 (C:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli}
dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav
vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg

Timeline for d1kmmc1:

• d1kmmc1 first appeared (with stable ids) in SCOP 1.55
  
• d1kmmc1 appears in SCOP 1.59
  
• d1kmmc1 appears in the current release, SCOPe 2.08