SCOPe 2.08: Domain d5lxgh_: 5lxg H:

Lineage for d5lxgh_ (5lxg H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d5lxgh_: 5lxg H: [331759]
   automated match to d3wxwh_
   complexed with so4, zn

Details for d5lxgh_

PDB Entry: 5lxg, 2.73 Å

PDB Description: revised crystal structure of the human adiponectin receptor 1 in an open conformation

PDB Compounds: (H:) V region heavy chain

SCOPe Domain Sequences for d5lxgh_:

Sequence; same for both SEQRES and ATOM records:

>d5lxgh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

Timeline for d5lxgh_:

• d5lxgh_ first appeared in SCOPe 2.06
  
• d5lxgh_ appears in SCOPe 2.07