Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) |
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) |
Species Escherichia coli [TaxId:562] [52957] (4 PDB entries) |
Domain d1kmma1: 1kmm A:326-424 [33174] Other proteins in same PDB: d1kmma2, d1kmmb2, d1kmmc2, d1kmmd2 protein/RNA complex; complexed with ham |
PDB Entry: 1kmm (more details), 2.6 Å
SCOPe Domain Sequences for d1kmma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmma1 c.51.1.1 (A:326-424) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Escherichia coli [TaxId: 562]} dpvvdiylvasgadtqsaamalaerlrdelpgvklmtnhgggnfkkqfaradkwgarvav vlgesevangtavvkdlrsgeqtavaqdsvaahlrtllg
Timeline for d1kmma1: