SCOPe 2.08: Domain d5mzab2: 5mza B:83-185

Lineage for d5mzab2 (5mza B:83-185)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)

8. Domain d5mzab2: 5mza B:83-185 [331737]
   Other proteins in same PDB: d5mzab1, d5mzab3
   automated match to d1z7zi1
   complexed with 3po, ihp, nag

Details for d5mzab2

PDB Entry: 5mza, 2.78 Å

PDB Description: the dblb domain of pf11_0521 pfemp1 bound to human icam-1

PDB Compounds: (B:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d5mzab2:

Sequence; same for both SEQRES and ATOM records:

>d5mzab2 b.1.1.3 (B:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf

Timeline for d5mzab2:

• d5mzab2 first appeared in SCOPe 2.06
  
• d5mzab2 appears in SCOPe 2.07