![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries) |
![]() | Domain d5mzab2: 5mza B:83-185 [331737] Other proteins in same PDB: d5mzab1, d5mzab3 automated match to d1z7zi1 complexed with 3po, ihp, nag |
PDB Entry: 5mza (more details), 2.78 Å
SCOPe Domain Sequences for d5mzab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mzab2 b.1.1.3 (B:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtf
Timeline for d5mzab2: