SCOPe 2.08: Domain d5b3sc_: 5b3s C:

Lineage for d5b3sc_ (5b3s C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d5b3sc_: 5b3s C: [331735]
   Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sq_, d5b3sr_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
   automated match to d1v54c_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3sc_

PDB Entry: 5b3s, 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d5b3sc_:

Sequence; same for both SEQRES and ATOM records:

>d5b3sc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d5b3sc_:

• d5b3sc_ first appeared in SCOPe 2.06
  
• d5b3sc_ appears in SCOPe 2.07