Lineage for d1bpma2 (1bpm A:1-159)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489006Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2489007Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2489008Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)
  6. 2489009Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)
  7. 2489010Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)
  8. 2489018Domain d1bpma2: 1bpm A:1-159 [33172]
    Other proteins in same PDB: d1bpma1
    complexed with mg, zn

Details for d1bpma2

PDB Entry: 1bpm (more details), 2.9 Å

PDB Description: differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
PDB Compounds: (A:) leucine aminopeptidase

SCOPe Domain Sequences for d1bpma2:

Sequence, based on SEQRES records: (download)

>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Sequence, based on observed residues (ATOM records): (download)

>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

SCOPe Domain Coordinates for d1bpma2:

Click to download the PDB-style file with coordinates for d1bpma2.
(The format of our PDB-style files is described here.)

Timeline for d1bpma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bpma1