Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (3 families) |
Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein) |
Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries) |
Domain d1bpma2: 1bpm A:1-159 [33172] Other proteins in same PDB: d1bpma1 complexed with mg, zn |
PDB Entry: 1bpm (more details), 2.9 Å
SCOPe Domain Sequences for d1bpma2:
Sequence, based on SEQRES records: (download)
>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl
>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl
Timeline for d1bpma2: