SCOPe 2.08: Domain d1bpma2: 1bpm A:1-159

Lineage for d1bpma2 (1bpm A:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)

6. Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)

8. Domain d1bpma2: 1bpm A:1-159 [33172]
   Other proteins in same PDB: d1bpma1
   complexed with mg, zn

Details for d1bpma2

PDB Entry: 1bpm, 2.9 Å

PDB Description: differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography

PDB Compounds: (A:) leucine aminopeptidase

SCOPe Domain Sequences for d1bpma2:

Sequence, based on SEQRES records:

>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Sequence, based on observed residues (ATOM records):

>d1bpma2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Timeline for d1bpma2:

• d1bpma2 first appeared (with stable ids) in SCOP 1.55, called d1bpm_1
  
• d1bpma2 appears in SCOPe 2.07