Lineage for d5lkyb_ (5lky B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836622Species Staphylococcus aureus [TaxId:93061] [193178] (7 PDB entries)
  8. 2836636Domain d5lkyb_: 5lky B: [331715]
    automated match to d4ahob_
    complexed with peg

Details for d5lkyb_

PDB Entry: 5lky (more details), 1.7 Å

PDB Description: x-ray crystal structure of n-acetylneuraminic acid lyase in complex with pyruvate, with the phenylalanine at position 190 replaced with the non-canonical amino acid dihydroxypropylcysteine.
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5lkyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lkyb_ c.1.10.0 (B:) automated matches {Staphylococcus aureus [TaxId: 93061]}
dlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkqv
fkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdyy
fdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkafpd
klilsgxdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndii
etvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5lkyb_:

Click to download the PDB-style file with coordinates for d5lkyb_.
(The format of our PDB-style files is described here.)

Timeline for d5lkyb_: