| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein Cytochrome c oxidase subunit E [48481] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [48482] (35 PDB entries) |
| Domain d5b3sr_: 5b3s R: [331713] Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ automated match to d1v54e_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn |
PDB Entry: 5b3s (more details), 1.68 Å
SCOPe Domain Sequences for d5b3sr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3sr_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5b3sr_:
View in 3DDomains from other chains: (mouse over for more information) d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3se_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_ |