Lineage for d5b3se_ (5b3s E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727233Domain d5b3se_: 5b3s E: [331702]
    Other proteins in same PDB: d5b3sa1, d5b3sa2, d5b3sb1, d5b3sb2, d5b3sb3, d5b3sc_, d5b3sd_, d5b3sf_, d5b3sg_, d5b3sh_, d5b3si1, d5b3si2, d5b3sj_, d5b3sk_, d5b3sl_, d5b3sm_, d5b3sn1, d5b3sn2, d5b3so1, d5b3so2, d5b3so3, d5b3sp_, d5b3sq_, d5b3ss_, d5b3st_, d5b3su_, d5b3sv1, d5b3sv2, d5b3sw_, d5b3sx_, d5b3sy_, d5b3sz_
    automated match to d1v54e_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d5b3se_

PDB Entry: 5b3s (more details), 1.68 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound mixed- valence state at 1.68 angstrom resolution (50 k)
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5b3se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3se_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5b3se_:

Click to download the PDB-style file with coordinates for d5b3se_.
(The format of our PDB-style files is described here.)

Timeline for d5b3se_: