Lineage for d1blle1 (1bll E:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881112Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)
  6. 2881113Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)
  7. 2881114Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)
  8. 2881119Domain d1blle1: 1bll E:1-159 [33170]
    Other proteins in same PDB: d1blle2
    complexed with zn

Details for d1blle1

PDB Entry: 1bll (more details), 2.4 Å

PDB Description: x-ray crystallographic determination of the structure of bovine lens leucine aminopeptidase complexed with amastatin: formulation of a catalytic mechanism featuring a gem-diolate transition state
PDB Compounds: (E:) leucine aminopeptidase

SCOPe Domain Sequences for d1blle1:

Sequence, based on SEQRES records: (download)

>d1blle1 c.50.1.1 (E:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Sequence, based on observed residues (ATOM records): (download)

>d1blle1 c.50.1.1 (E:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

SCOPe Domain Coordinates for d1blle1:

Click to download the PDB-style file with coordinates for d1blle1.
(The format of our PDB-style files is described here.)

Timeline for d1blle1: