Lineage for d5lhac_ (5lha C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897817Species Pseudomonas sp. [TaxId:306] [315480] (8 PDB entries)
  8. 2897826Domain d5lhac_: 5lha C: [331691]
    automated match to d3drda_
    complexed with pmp

Details for d5lhac_

PDB Entry: 5lha (more details), 1.89 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
PDB Compounds: (C:) omega transaminase

SCOPe Domain Sequences for d5lhac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhac_ c.67.1.0 (C:) automated matches {Pseudomonas sp. [TaxId: 306]}
ekyknaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnr
asvkaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdaveta
lkmarqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpw
lyrnpwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlr
evcdrhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqri
adaiengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqpl
veryavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkii
lsppltltrdeaglmvsaleaafarcg

SCOPe Domain Coordinates for d5lhac_:

Click to download the PDB-style file with coordinates for d5lhac_.
(The format of our PDB-style files is described here.)

Timeline for d5lhac_: