Lineage for d5lh9a_ (5lh9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505405Species Pseudomonas sp. [TaxId:306] [315480] (7 PDB entries)
  8. 2505416Domain d5lh9a_: 5lh9 A: [331689]
    automated match to d3drda_
    complexed with plp

Details for d5lh9a_

PDB Entry: 5lh9 (more details), 1.95 Å

PDB Description: amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
PDB Compounds: (A:) omega transaminase

SCOPe Domain Sequences for d5lh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lh9a_ c.67.1.0 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
knaekkfwhpmgssaaphrdktlviargdgnyitdidgqrmldgvgglwnvnighnrasv
kaaiaaqldelayyqtfdgiahprvfdlaerltgmfaqermarvlfssggsdavetalkm
arqywiasgepgrtrflslrngyhgvhmggtsvggngvyhynhgqllagchlldtpwlyr
npwdcrdpqaltahcirqleeqiallgaqtiaaliaepvqgaggvivppadywprlrevc
drhgilliadevvtgfgrsgcmlgsrgwgvapdilclakgitagyiplgatlfnqriada
iengqgfshmimhgytysghptacaaalavldiveaedlpgnaakvgaqlleqlqplver
yavvgevrgkglmialdlvsdkrtrqpldpaagqpsriadearragvlvrpignkiilsp
pltltrdeaglmvsaleaafarcg

SCOPe Domain Coordinates for d5lh9a_:

Click to download the PDB-style file with coordinates for d5lh9a_.
(The format of our PDB-style files is described here.)

Timeline for d5lh9a_: