Lineage for d5fyeb_ (5fye B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149676Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2149807Protein automated matches [191218] (4 species)
    not a true protein
  7. 2149823Species Pseudomonas aeruginosa [TaxId:287] [329970] (6 PDB entries)
  8. 2149834Domain d5fyeb_: 5fye B: [331687]
    automated match to d1fxob_
    complexed with cl, ld6, mes

Details for d5fyeb_

PDB Entry: 5fye (more details), 2.4 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor
PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5fyeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fyeb_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

SCOPe Domain Coordinates for d5fyeb_:

Click to download the PDB-style file with coordinates for d5fyeb_.
(The format of our PDB-style files is described here.)

Timeline for d5fyeb_: