SCOPe 2.06: Domain d5fyeb_: 5fye B:

Lineage for d5fyeb_ (5fye B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
   automatically mapped to Pfam PF00483

6. Protein automated matches [191218] (4 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [329970] (6 PDB entries)

8. Domain d5fyeb_: 5fye B: [331687]
   automated match to d1fxob_
   complexed with cl, ld6, mes

Details for d5fyeb_

PDB Entry: 5fye, 2.4 Å

PDB Description: pseudomonas aeruginosa rmla in complex with allosteric inhibitor

PDB Compounds: (B:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5fyeb_:

Sequence; same for both SEQRES and ATOM records:

>d5fyeb_ c.68.1.6 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagireiliistpqdtp
rfqqllgdgsnwgldlqyavqpspdglaqafligesfigndlsalvlgdnlyyghdfhel
lgsasqrqtgasvfayhvldperygvvefdqggkaisleekplepksnyavtglyfydqq
vvdiardlkpsprgeleitdvnraylergqlsveimgrgyawldtgthdslleagqfiat
lenrqglkvacpeeiayrqkwidaaqleklaaplakngygqylkrlltetvy

Timeline for d5fyeb_:

• d5fyeb_ is new in SCOPe 2.06-stable
  
• d5fyeb_ appears in SCOPe 2.07
  
• d5fyeb_ appears in the current release, SCOPe 2.08