SCOP 1.55: Domain d1lcpb1: 1lcp B:1-159

Lineage for d1lcpb1 (1lcp B:1-159)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.50: Leucine aminopeptidase, N-terminal domain [52948] (1 superfamily)

4. Superfamily c.50.1: Leucine aminopeptidase, N-terminal domain [52949] (1 family)

5. Family c.50.1.1: Leucine aminopeptidase, N-terminal domain [52950] (1 protein)

6. Protein Leucine aminopeptidase, N-terminal domain [52951] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)

8. Domain d1lcpb1: 1lcp B:1-159 [33168]
   Other proteins in same PDB: d1lcpa2, d1lcpb2

Details for d1lcpb1

PDB Entry: 1lcp, 1.65 Å

PDB Description: bovine lens leucine aminopeptidase complexed with l-leucine phosphonic acid

SCOP Domain Sequences for d1lcpb1:

Sequence; same for both SEQRES and ATOM records:

>d1lcpb1 c.50.1.1 (B:1-159) Leucine aminopeptidase, N-terminal domain {Cow (Bos taurus)}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

Timeline for d1lcpb1:

• d1lcpb1 appears in SCOP 1.57
  
• d1lcpb1 appears in the current release, SCOPe 2.08