Lineage for d5iq2c_ (5iq2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2903183Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries)
  8. 2903221Domain d5iq2c_: 5iq2 C: [331673]
    automated match to d4j7aa_
    mutant

Details for d5iq2c_

PDB Entry: 5iq2 (more details), 1.78 Å

PDB Description: crystal structure of esterase mutant - l255w
PDB Compounds: (C:) esterase

SCOPe Domain Sequences for d5iq2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iq2c_ c.69.1.0 (C:) automated matches {Uncultured bacterium [TaxId: 77133]}
lpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqaw
qtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthgggm
viltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnre
algistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsll
endayfwdmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrde
glahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra

SCOPe Domain Coordinates for d5iq2c_:

Click to download the PDB-style file with coordinates for d5iq2c_.
(The format of our PDB-style files is described here.)

Timeline for d5iq2c_: