Lineage for d1lama2 (1lam A:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120594Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)
  6. 2120595Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)
  7. 2120596Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)
  8. 2120597Domain d1lama2: 1lam A:1-159 [33166]
    Other proteins in same PDB: d1lama1
    complexed with co3, mrd, zn

Details for d1lama2

PDB Entry: 1lam (more details), 1.6 Å

PDB Description: leucine aminopeptidase (unligated)
PDB Compounds: (A:) leucine aminopeptidase

SCOPe Domain Sequences for d1lama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lama2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

SCOPe Domain Coordinates for d1lama2:

Click to download the PDB-style file with coordinates for d1lama2.
(The format of our PDB-style files is described here.)

Timeline for d1lama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lama1