SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lama2 (1lam A:1-159)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120592Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2120593Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2120594Family c.50.1.1: Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52950] (1 protein)
  6. 2120595Protein Leucine aminopeptidase (Aminopeptidase A), N-terminal domain [52951] (2 species)
  7. 2120596Species Cow (Bos taurus) [TaxId:9913] [52952] (7 PDB entries)
  8. 2120597Domain d1lama2: 1lam A:1-159 [33166]
    Other proteins in same PDB: d1lama1
    complexed with co3, mrd, zn

Details for d1lama2

PDB Entry: 1lam (more details), 1.6 Å

PDB Description: leucine aminopeptidase (unligated)
PDB Compounds: (A:) leucine aminopeptidase

SCOPe Domain Sequences for d1lama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lama2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvl

SCOPe Domain Coordinates for d1lama2:

Click to download the PDB-style file with coordinates for d1lama2.
(The format of our PDB-style files is described here.)

Timeline for d1lama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lama1