Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
Protein automated matches [190506] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188989] (3 PDB entries) |
Domain d5ji1a_: 5ji1 A: [331658] automated match to d3hh2a_ complexed with mpd |
PDB Entry: 5ji1 (more details), 2.25 Å
SCOPe Domain Sequences for d5ji1a_:
Sequence, based on SEQRES records: (download)
>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs
>d5ji1a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvnprgsagpcc tptkmspinmlyfngkeqiiygkipamvvdrcgcs
Timeline for d5ji1a_: