SCOPe 2.08: Domain d5ihwa2: 5ihw A:424-591

Lineage for d5ihwa2 (5ihw A:424-591)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282459] [331651] (1 PDB entry)

8. Domain d5ihwa2: 5ihw A:424-591 [331653]
   automated match to d1r19a2

Details for d5ihwa2

PDB Entry: 5ihw, 1.25 Å

PDB Description: the crystal structure of sdre from staphylococcus aureus

PDB Compounds: (A:) Serine-aspartate repeat-containing protein E

SCOPe Domain Sequences for d5ihwa2:

Sequence; same for both SEQRES and ATOM records:

>d5ihwa2 b.2.3.0 (A:424-591) automated matches {Staphylococcus aureus [TaxId: 282459]}
qdpmvhgdsniqsiftkldedkqtieqqiyvnplkksatntkvdiagsqvddygniklgn
gstiidqnteikvykvnsdqqlpqsnriydfsqyedvtsqfdnkksfsnnvatldfgdin
sayiikvvskytptsdgeldiaqgtsmrttdkygyynyagysnfivts

Timeline for d5ihwa2:

• d5ihwa2 first appeared in SCOPe 2.06
  
• d5ihwa2 appears in SCOPe 2.07