SCOPe 2.07: Domain d5gona2: 5gon A:246-439

Lineage for d5gona2 (5gon A:246-439)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

Domain d5gona2: 5gon A:246-439 [331639]
Other proteins in same PDB: d5gona1, d5gonb1, d5gonc1, d5gond1, d5gone_, d5gonf1, d5gonf2
automated match to d1tuba2
complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gona2

PDB Entry: 5gon (more details), 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5gona2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gona2 d.79.2.1 (A:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

SCOPe Domain Coordinates for d5gona2:

Click to download the PDB-style file with coordinates for d5gona2.
(The format of our PDB-style files is described here.)

Timeline for d5gona2: