Lineage for d5jfba1 (5jfb A:477-577)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. Superfamily d.170.1: SRCR-like [56487] (3 families) (S)
  5. Family d.170.1.0: automated matches [331628] (1 protein)
    not a true family
  6. Protein automated matches [331629] (4 species)
    not a true protein
  7. Species Pig (Sus scrofa) [TaxId:9823] [331630] (2 PDB entries)
  8. Domain d5jfba1: 5jfb A:477-577 [331631]
    Other proteins in same PDB: d5jfba2, d5jfba3
    automated match to d1by2a_

Details for d5jfba1

PDB Entry: 5jfb (more details), 2 Å

PDB Description: crystal structure of the scavenger receptor cysteine-rich domain 5 (srcr5) from porcine cd163
PDB Compounds: (A:) Scavenger receptor cysteine-rich type 1 protein M130

SCOPe Domain Sequences for d5jfba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jfba1 d.170.1.0 (A:477-577) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcs

SCOPe Domain Coordinates for d5jfba1 are not available.

Timeline for d5jfba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jfba2, d5jfba3