SCOPe 2.06: Domain d5gonc2: 5gon C:246-440

Lineage for d5gonc2 (5gon C:246-440)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries)

8. Domain d5gonc2: 5gon C:246-440 [331619]
   Other proteins in same PDB: d5gona1, d5gonb1, d5gonc1, d5gond1, d5gone_, d5gonf1, d5gonf2
   automated match to d1tuba2
   complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg

Details for d5gonc2

PDB Entry: 5gon, 2.48 Å

PDB Description: structures of a beta-lactam bridged analogue in complex with tubulin

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5gonc2:

Sequence; same for both SEQRES and ATOM records:

>d5gonc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

Timeline for d5gonc2:

• d5gonc2 is new in SCOPe 2.06-stable
  
• d5gonc2 appears in SCOPe 2.07
  
• d5gonc2 appears in the current release, SCOPe 2.08