Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (48 PDB entries) |
Domain d5gonc2: 5gon C:246-440 [331619] Other proteins in same PDB: d5gona1, d5gonb1, d5gonc1, d5gond1, d5gone_, d5gonf1, d5gonf2 automated match to d1tuba2 complexed with 6zr, ca, gdp, gol, gtp, imd, mes, mg |
PDB Entry: 5gon (more details), 2.48 Å
SCOPe Domain Sequences for d5gonc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gonc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5gonc2: