Lineage for d1nbmg_ (1nbm G:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24665Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
  5. 24666Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 24667Protein ATP syntase (F1-ATPase), gamma subunit [52945] (2 species)
  7. 24668Species Cow (Bos taurus) [TaxId:9913] [52946] (7 PDB entries)
  8. 24673Domain d1nbmg_: 1nbm G: [33161]
    Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3

Details for d1nbmg_

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmg_:

Sequence, based on SEQRES records: (download)

>d1nbmg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1nbmg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOP Domain Coordinates for d1nbmg_:

Click to download the PDB-style file with coordinates for d1nbmg_.
(The format of our PDB-style files is described here.)

Timeline for d1nbmg_: