Lineage for d1e1rg_ (1e1r G:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24665Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
  5. 24666Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 24667Protein ATP syntase (F1-ATPase), gamma subunit [52945] (2 species)
  7. 24668Species Cow (Bos taurus) [TaxId:9913] [52946] (7 PDB entries)
  8. 24670Domain d1e1rg_: 1e1r G: [33159]
    Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1ra3, d1e1rb1, d1e1rb2, d1e1rb3, d1e1rc1, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3

Details for d1e1rg_

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1rg_:

Sequence, based on SEQRES records: (download)

>d1e1rg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1e1rg_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

SCOP Domain Coordinates for d1e1rg_:

Click to download the PDB-style file with coordinates for d1e1rg_.
(The format of our PDB-style files is described here.)

Timeline for d1e1rg_: