Lineage for d1e79g_ (1e79 G:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24665Superfamily c.49.2: ATP syntase (F1-ATPase), gamma subunit [52943] (1 family) (S)
  5. 24666Family c.49.2.1: ATP syntase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 24667Protein ATP syntase (F1-ATPase), gamma subunit [52945] (2 species)
  7. 24668Species Cow (Bos taurus) [TaxId:9913] [52946] (7 PDB entries)
  8. 24669Domain d1e79g_: 1e79 G: [33158]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79h1, d1e79h2, d1e79i_

Details for d1e79g_

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79g_:

Sequence, based on SEQRES records: (download)

>d1e79g_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d1e79g_ c.49.2.1 (G:) ATP syntase (F1-ATPase), gamma subunit {Cow (Bos taurus)}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
eliigvssdrglcgaihssvakqmkseaanlkevkiigvgdkirsilhrthsdqflvtfk
evgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifsldtissaes
msiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknasemidkltlt
fnrtrqavitkelieiisgaaal

SCOP Domain Coordinates for d1e79g_:

Click to download the PDB-style file with coordinates for d1e79g_.
(The format of our PDB-style files is described here.)

Timeline for d1e79g_: