Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries) |
Domain d5gthi_: 5gth I: [331574] Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthf_, d5gthh_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_ automated match to d4ub8i_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gth (more details), 2.5 Å
SCOPe Domain Sequences for d5gthi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gthi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]} metlkitvyivvtffvllfvfgflsgdparnpkrkdle
Timeline for d5gthi_: