Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) |
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
Protein automated matches [191000] (6 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (15 PDB entries) |
Domain d5gthf_: 5gth f: [331572] Other proteins in same PDB: d5gtha_, d5gthb_, d5gthc_, d5gthd_, d5gthe_, d5gthh_, d5gthi_, d5gthj_, d5gthk_, d5gthl_, d5gthm1, d5gthm2, d5gtho_, d5gtht_, d5gthu_, d5gthv_, d5gthx_, d5gthz_ automated match to d2axtf1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 5gth (more details), 2.5 Å
SCOPe Domain Sequences for d5gthf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gthf_ f.23.38.1 (f:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} iftvrwvavhtlavptifflgaiaamqfiqr
Timeline for d5gthf_: