Lineage for d5x0va1 (5x0v A:86-301)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916423Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries)
  8. 2916430Domain d5x0va1: 5x0v A:86-301 [331563]
    Other proteins in same PDB: d5x0va2, d5x0vb2
    automated match to d1i6aa_
    complexed with cit, cl

Details for d5x0va1

PDB Entry: 5x0v (more details), 1.6 Å

PDB Description: reduced form of regulatory domain of oxyr2 from vibrio vulnificus
PDB Compounds: (A:) LysR family transcriptional regulator

SCOPe Domain Sequences for d5x0va1:

Sequence, based on SEQRES records: (download)

>d5x0va1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
elgslcqgdsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrh
geldvlilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekeh
cltehavsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvi
eppgqqayrdiglvwrpsssrsktfnqlaevvsell

Sequence, based on observed residues (ATOM records): (download)

>d5x0va1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]}
eldsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvl
ilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekehclteha
vsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqq
ayrdiglvwrpsssrsktfnqlaevvsell

SCOPe Domain Coordinates for d5x0va1:

Click to download the PDB-style file with coordinates for d5x0va1.
(The format of our PDB-style files is described here.)

Timeline for d5x0va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5x0va2