![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Vibrio vulnificus [TaxId:672] [330964] (5 PDB entries) |
![]() | Domain d5x0va1: 5x0v A:86-301 [331563] Other proteins in same PDB: d5x0va2, d5x0vb2 automated match to d1i6aa_ complexed with cit, cl |
PDB Entry: 5x0v (more details), 1.6 Å
SCOPe Domain Sequences for d5x0va1:
Sequence, based on SEQRES records: (download)
>d5x0va1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]} elgslcqgdsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrh geldvlilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekeh cltehavsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvi eppgqqayrdiglvwrpsssrsktfnqlaevvsell
>d5x0va1 c.94.1.0 (A:86-301) automated matches {Vibrio vulnificus [TaxId: 672]} eldsmqgqlklgciptiapfllcdlvqeinqrfpqlnlllredtttnlltalrhgeldvl ilalpveidgmesrvvgqdpfkmvisrhqagaikvpikyddlpdesvfllekehclteha vsackltdkekinpfsatslhtlvqmvanglgttfipqmaidhglldnqnlvvieppgqq ayrdiglvwrpsssrsktfnqlaevvsell
Timeline for d5x0va1: