| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
| Domain d5uaub2: 5uau B:165-274 [331554] Other proteins in same PDB: d5uaua1, d5uaub1, d5uaub3, d5uauc1, d5uauc3, d5uaud1, d5uaue1 automated match to d2izzc2 complexed with pro, so4 |
PDB Entry: 5uau (more details), 1.9 Å
SCOPe Domain Sequences for d5uaub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uaub2 a.100.1.0 (B:165-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadq
Timeline for d5uaub2: