Lineage for d1e0ub3 (1e0u B:354-470)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71332Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 71333Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 71334Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 71335Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 71343Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 71353Domain d1e0ub3: 1e0u B:354-470 [33155]
    Other proteins in same PDB: d1e0ua1, d1e0ua2, d1e0ub1, d1e0ub2, d1e0uc1, d1e0uc2, d1e0ud1, d1e0ud2

Details for d1e0ub3

PDB Entry: 1e0u (more details), 2.8 Å

PDB Description: structure r271l mutant of e. coli pyruvate kinase

SCOP Domain Sequences for d1e0ub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0ub3 c.49.1.1 (B:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOP Domain Coordinates for d1e0ub3:

Click to download the PDB-style file with coordinates for d1e0ub3.
(The format of our PDB-style files is described here.)

Timeline for d1e0ub3: