![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
![]() | Domain d5uavc2: 5uav C:165-273 [331532] Other proteins in same PDB: d5uava1, d5uava3, d5uavb1, d5uavb3, d5uavc1, d5uavc3, d5uavd1, d5uavd3, d5uave1, d5uave3 automated match to d2izzc2 complexed with ndp, peg, tfb |
PDB Entry: 5uav (more details), 1.85 Å
SCOPe Domain Sequences for d5uavc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uavc2 a.100.1.0 (C:165-273) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmad
Timeline for d5uavc2: