| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
| Domain d5uavc1: 5uav C:1-164 [331531] Other proteins in same PDB: d5uava2, d5uava3, d5uavb2, d5uavb3, d5uavc2, d5uavc3, d5uavd2, d5uavd3, d5uave2, d5uave3 automated match to d2izza1 complexed with ndp, peg, tfb |
PDB Entry: 5uav (more details), 1.85 Å
SCOPe Domain Sequences for d5uavc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uavc1 c.2.1.0 (C:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d5uavc1: