SCOP 1.57: Domain d1pkyb3: 1pky B:351-470

Lineage for d1pkyb3 (1pky B:351-470)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)

4. Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (5 species)

7. Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)

8. Domain d1pkyb3: 1pky B:351-470 [33151]
   Other proteins in same PDB: d1pkya1, d1pkya2, d1pkyb1, d1pkyb2, d1pkyc1, d1pkyc2, d1pkyd1, d1pkyd2

Details for d1pkyb3

PDB Entry: 1pky, 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyb3:

Sequence; same for both SEQRES and ATOM records:

>d1pkyb3 c.49.1.1 (B:351-470) Pyruvate kinase, C-terminal domain {Escherichia coli}
klriteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlv
lskgvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

Timeline for d1pkyb3:

• d1pkyb3 first appeared (with stable ids) in SCOP 1.55
  
• d1pkyb3 appears in SCOP 1.59
  
• d1pkyb3 appears in the current release, SCOPe 2.08