Lineage for d1pkyb3 (1pky B:351-470)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24606Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
  4. 24607Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) (S)
  5. 24608Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
  6. 24609Protein Pyruvate kinase, C-terminal domain [52937] (5 species)
  7. 24617Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 24623Domain d1pkyb3: 1pky B:351-470 [33151]
    Other proteins in same PDB: d1pkya1, d1pkya2, d1pkyb1, d1pkyb2, d1pkyc1, d1pkyc2, d1pkyd1, d1pkyd2

Details for d1pkyb3

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyb3 c.49.1.1 (B:351-470) Pyruvate kinase, C-terminal domain {Escherichia coli}
klriteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlv
lskgvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOP Domain Coordinates for d1pkyb3:

Click to download the PDB-style file with coordinates for d1pkyb3.
(The format of our PDB-style files is described here.)

Timeline for d1pkyb3: