SCOPe 2.07: Domain d5uaud1: 5uau D:1-164

Lineage for d5uaud1 (5uau D:1-164)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (247 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (47 PDB entries)

8. Domain d5uaud1: 5uau D:1-164 [331501]
   Other proteins in same PDB: d5uaua2, d5uaub2, d5uaub3, d5uauc2, d5uauc3, d5uaud2, d5uaue2
   automated match to d2izza1
   complexed with pro, so4

Details for d5uaud1

PDB Entry: 5uau, 1.9 Å

PDB Description: structure of human pycr-1 complexed with proline

PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uaud1:

Sequence; same for both SEQRES and ATOM records:

>d5uaud1 c.2.1.0 (D:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

Timeline for d5uaud1:

• d5uaud1 first appeared in SCOPe 2.06