Lineage for d1pkya3 (1pky A:351-470)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488766Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 2488767Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 2488768Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 2488776Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)
  8. 2488781Domain d1pkya3: 1pky A:351-470 [33150]
    Other proteins in same PDB: d1pkya1, d1pkya2, d1pkyb1, d1pkyb2, d1pkyc1, d1pkyc2, d1pkyd1, d1pkyd2

Details for d1pkya3

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state
PDB Compounds: (A:) pyruvate kinase

SCOPe Domain Sequences for d1pkya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkya3 c.49.1.1 (A:351-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
klriteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlv
lskgvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

SCOPe Domain Coordinates for d1pkya3:

Click to download the PDB-style file with coordinates for d1pkya3.
(The format of our PDB-style files is described here.)

Timeline for d1pkya3: