| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Providencia stuartii [TaxId:588] [331391] (6 PDB entries) |
| Domain d5us1k1: 5us1 K:1-178 [331484] Other proteins in same PDB: d5us1a2, d5us1c2, d5us1e2, d5us1j2, d5us1k2 automated match to d1m44a_ complexed with 8mm, aco, coa, gol, tar |
PDB Entry: 5us1 (more details), 2.48 Å
SCOPe Domain Sequences for d5us1k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5us1k1 d.108.1.0 (K:1-178) automated matches {Providencia stuartii [TaxId: 588]}
mgieyrslhtsqltlsekealydlliegfegdfshddfahtlggmhvmafdqqklvghva
iiqrhmaldntpisvgyveamvveqsyrrqgigrqlmlqtnkiiascyqlgllsasddgq
klyhsvgwqiwkgklfelkqgsyirsieeeggvmgwkadgevdftaslycdfrggdqw
Timeline for d5us1k1: