![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) |
![]() | Superfamily c.49.1: Pyruvate kinase, C-terminal domain [52935] (1 family) ![]() |
![]() | Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) |
![]() | Protein Pyruvate kinase, C-terminal domain [52937] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [52942] (3 PDB entries) |
![]() | Domain d1e0tc3: 1e0t C:354-470 [33148] Other proteins in same PDB: d1e0ta1, d1e0ta2, d1e0tb1, d1e0tb2, d1e0tc1, d1e0tc2, d1e0td1, d1e0td2 |
PDB Entry: 1e0t (more details), 1.8 Å
SCOP Domain Sequences for d1e0tc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0tc3 c.49.1.1 (C:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli} iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl
Timeline for d1e0tc3: