Lineage for d5th9l2 (5th9 L:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2753415Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (5 PDB entries)
  8. 2753418Domain d5th9l2: 5th9 L:107-214 [331475]
    Other proteins in same PDB: d5th9h1, d5th9h2, d5th9i1, d5th9i2, d5th9j1, d5th9j2, d5th9l1, d5th9m1, d5th9n_
    automated match to d1dn0a2
    complexed with ca, nco, zn

Details for d5th9l2

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (L:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9l2 b.1.1.2 (L:107-214) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5th9l2:

Click to download the PDB-style file with coordinates for d5th9l2.
(The format of our PDB-style files is described here.)

Timeline for d5th9l2: