Lineage for d5th9l1 (5th9 L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761410Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)
  8. 2761516Domain d5th9l1: 5th9 L:1-106 [331474]
    Other proteins in same PDB: d5th9h2, d5th9i2, d5th9j2, d5th9l2, d5th9m2, d5th9n_
    automated match to d1dn0a1
    complexed with ca, nco, zn

Details for d5th9l1

PDB Entry: 5th9 (more details), 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)
PDB Compounds: (L:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5th9l1 b.1.1.0 (L:1-106) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkvei

SCOPe Domain Coordinates for d5th9l1:

Click to download the PDB-style file with coordinates for d5th9l1.
(The format of our PDB-style files is described here.)

Timeline for d5th9l1: