SCOPe 2.08: Domain d5th9l1: 5th9 L:1-106

Lineage for d5th9l1 (5th9 L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d5th9l1: 5th9 L:1-106 [331474]
   Other proteins in same PDB: d5th9h2, d5th9i2, d5th9j2, d5th9l2, d5th9m2, d5th9n_
   automated match to d1dn0a1
   complexed with ca, nco, zn

Details for d5th9l1

PDB Entry: 5th9, 3 Å

PDB Description: structure determination of a potent, selective antibody inhibitor of human mmp9 (gs-5745 bound to mmp-9)

PDB Compounds: (L:) GS-5745 Fab light chain

SCOPe Domain Sequences for d5th9l1:

Sequence; same for both SEQRES and ATOM records:

>d5th9l1 b.1.1.0 (L:1-106) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
diqmtqspsslsasvgdrvtitckasqdvrntvawyqqkpgkapklliysssyrntgvpd
rfsgsgsgtdftltisslqaedvavyycqqhyitpytfgggtkvei

Timeline for d5th9l1:

• d5th9l1 first appeared in SCOPe 2.06
  
• d5th9l1 appears in SCOPe 2.07