Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (30 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:216595] [189073] (2 PDB entries) |
Domain d5v00b_: 5v00 B: [331471] automated match to d3esgb_ complexed with fmt, gol |
PDB Entry: 5v00 (more details), 1.8 Å
SCOPe Domain Sequences for d5v00b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5v00b_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]} saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie ltqrg
Timeline for d5v00b_: