SCOPe 2.08: Domain d5v00b_: 5v00 B:

Lineage for d5v00b_ (5v00 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.0: automated matches [191354] (1 protein)
   not a true family

6. Protein automated matches [190388] (30 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:216595] [189073] (2 PDB entries)

8. Domain d5v00b_: 5v00 B: [331471]
   automated match to d3esgb_
   complexed with fmt, gol

Details for d5v00b_

PDB Entry: 5v00, 1.8 Å

PDB Description: structure of hutd from pseudomonas fluorescens sbw25 (formate condition)

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d5v00b_:

Sequence; same for both SEQRES and ATOM records:

>d5v00b_ b.82.1.0 (B:) automated matches {Pseudomonas fluorescens [TaxId: 216595]}
saisvwravdyvrmpwkngggsteeitrdagtglegfgwrlsiadigesggfssfagyqr
vitviqgagmvltvdgeeqrgllplqpfafrgdsqvscrlitgpirdfnliysperyhar
lqwvdgvqrffstaqtvlvfsvadevkvlgeklghhdclqvdgnaglldisvtgrcclie
ltqrg

Timeline for d5v00b_:

• d5v00b_ first appeared in SCOPe 2.06
  
• d5v00b_ appears in SCOPe 2.07