SCOPe 2.01: Domain d1e0tb3: 1e0t B:354-470

Lineage for d1e0tb3 (1e0t B:354-470)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families)

5. Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)

6. Protein Pyruvate kinase, C-terminal domain [52937] (6 species)

7. Species Escherichia coli [TaxId:562] [52942] (3 PDB entries)

8. Domain d1e0tb3: 1e0t B:354-470 [33147]
   Other proteins in same PDB: d1e0ta1, d1e0ta2, d1e0tb1, d1e0tb2, d1e0tc1, d1e0tc2, d1e0td1, d1e0td2
   complexed with so4; mutant

Details for d1e0tb3

PDB Entry: 1e0t, 1.8 Å

PDB Description: r292d mutant of e. coli pyruvate kinase

PDB Compounds: (B:) pyruvate kinase

SCOPe Domain Sequences for d1e0tb3:

Sequence; same for both SEQRES and ATOM records:

>d1e0tb3 c.49.1.1 (B:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]}
iteavcrgavetaekldaplivvatqggksaravrkyfpdatilalttnektahqlvlsk
gvvpqlvkeitstddfyrlgkelalqsglahkgdvvvmvsgalvpsgttntasvhvl

Timeline for d1e0tb3:

• d1e0tb3 first appeared (with stable ids) in SCOP 1.55
  
• d1e0tb3 appears in SCOP 1.75
  
• d1e0tb3 appears in SCOPe 2.02
  
• d1e0tb3 appears in the current release, SCOPe 2.08