![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
![]() | Domain d5uawc2: 5uaw C:165-274 [331467] Other proteins in same PDB: d5uawa1, d5uawb1, d5uawb3, d5uawc1, d5uawd1, d5uawd3, d5uawe1, d5uawe3 automated match to d2izzc2 complexed with so4 |
PDB Entry: 5uaw (more details), 1.85 Å
SCOPe Domain Sequences for d5uawc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5uawc2 a.100.1.0 (C:165-274) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadq
Timeline for d5uawc2: