SCOPe 2.08: Domain d5uaua2: 5uau A:165-274

Lineage for d5uaua2 (5uau A:165-274)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)

8. Domain d5uaua2: 5uau A:165-274 [331465]
   Other proteins in same PDB: d5uaua1, d5uaub1, d5uaub3, d5uauc1, d5uauc3, d5uaud1, d5uaue1
   automated match to d2izzc2
   complexed with pro, so4

Details for d5uaua2

PDB Entry: 5uau, 1.9 Å

PDB Description: structure of human pycr-1 complexed with proline

PDB Compounds: (A:) Pyrroline-5-carboxylate reductase 1, mitochondrial

SCOPe Domain Sequences for d5uaua2:

Sequence; same for both SEQRES and ATOM records:

>d5uaua2 a.100.1.0 (A:165-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadq

Timeline for d5uaua2:

• d5uaua2 first appeared in SCOPe 2.06
  
• d5uaua2 appears in SCOPe 2.07